<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1-1-092 1-1-092 Nigeria 2008 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, V118I, K122AV, D123NS, K173T, Q174K, D177E, I178L, T200A, Q207E, R211RK, F214L, P243S, V245Q, E248D  
>1-1-092| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DVSFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIQLPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV, K20I, E35Q, M36I, N37ND, R41K, R57K, D60DE, C67E, H69K, V82I, L89M  
>1-1-092| codons 15-99
VGGQLIEALLDTGADDTVLEQIDLPGKWKPKMIGGIGGFIKVKQYEQILIEIEGKKAIGT
VLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Diallo, K Viral genetic diversity and polymorphisms in a cohort of HIV-1-infected patients eligible for initiation of antiretroviral therapy in Abuja, Nigeria. AIDS Res Hum Retroviruses, 2015