<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1-1-011 1-1-011 Nigeria 2008 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G17E, K20I, M36I, N37ND, R41K, L63H, I64IM, H69K, L89M  
>1-1-011| codons 15-99
VGEQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYDQIHMEICGKKAIGT
VLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, E36D, T39TA, K122E, S162A, K173T, Q174K, D177DE, I178IMV, T200A, Q207E, R211RKNS, V245Q  
>1-1-011| codons 1-249
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTDICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEK

References
Author Title Citation
Diallo, K Viral genetic diversity and polymorphisms in a cohort of HIV-1-infected patients eligible for initiation of antiretroviral therapy in Abuja, Nigeria. AIDS Res Hum Retroviruses, 2015