<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2-1-129 2-1-129 Nigeria 2008 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  K43KT K20I, E35Q, M36MIV, N37D, R41K, R57RK, L63P, C67X, H69K, K70KR, V82I, L89M  
>2-1-129| codons 15-99
IGGQLIEALLDTGADDTVLEQVDLPGKWTPKMIGGIGGFIKVKQYDQIPIEIXGKRAIGT
VLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20KR, V35T, V60I, K104R, K122E, D123N, F171FY, K173T, Q174KR, D177E, T200A, Q207D, R211RK, F214L, V245Q  
>2-1-129| codons 1-249
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRTRNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEK

References
Author Title Citation
Diallo, K Viral genetic diversity and polymorphisms in a cohort of HIV-1-infected patients eligible for initiation of antiretroviral therapy in Abuja, Nigeria. AIDS Res Hum Retroviruses, 2015