<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1-1-157 1-1-157 Nigeria 2008 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4PS, V35T, T39L, V60I, K64KR, V118I, K122KEIV, E138A, K173T, Q174K, T200A, I202V, Q207E, R211K, F214L, P243PS, V245Q, E248D  
>1-1-157| codons 1-249
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPI
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DVDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKVEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIQLPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20I, E35Q, M36I, N37ND, R41K, R57K, L63A, C67E, H69K, V82I, L89M  
>1-1-157| codons 15-99
IGGQLIEALLDTGADDTVLEQIDLPGKWKPKMIGGIGGFIKVKQYDQIAIEIEGKKAIGT
VLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Diallo, K Viral genetic diversity and polymorphisms in a cohort of HIV-1-infected patients eligible for initiation of antiretroviral therapy in Abuja, Nigeria. AIDS Res Hum Retroviruses, 2015