<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1-1-010 1-1-010 Nigeria 2008 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV, K20I, E35Q, M36I, N37D, R41K, R57K, Q61DE, L63S, C67E, H69K, V82I, L89M  
>1-1-010| codons 15-99
VGGQLIEALLDTGADDTVLEQIDLPGKWKPKMIGGIGGFIKVKQYDEISIEIEGKKAIGT
VLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39TI, V60I, K122E, D123G, I135T, F171Y, K173A, Q174K, D177E, I178M, G196E, T200A, E204EK, Q207E, V245K, E248D  
>1-1-010| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICIEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRAKNPEMVI
YQYMDDLYVGSDLEIEQHRAKIEKLREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPDK

References
Author Title Citation
Diallo, K Viral genetic diversity and polymorphisms in a cohort of HIV-1-infected patients eligible for initiation of antiretroviral therapy in Abuja, Nigeria. AIDS Res Hum Retroviruses, 2015