<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2-1-075 2-1-075 Nigeria 2008 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, K20I, E35Q, M36I, R41T, R57K, I62V, L63H, I64M, C67E, H69KR, V82I, L89M  
>2-1-075| codons 15-99
VGGQLIEALLDTGADDTVLEQINLPGTWKPKMIGGIGGFIKVKQYDQVHMEIEGRKAIGT
VLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39M, V60I, K122E, D123N, F171Y, K173T, Q174K, D177E, I178IM, V189VI, T200A, Q207D, R211K, F214L, V245KQ  
>2-1-075| codons 1-249
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRTKNPEMVI
YQYMDDLYIGSDLEIGQHRAKIEELRDHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEK

References
Author Title Citation
Diallo, K Viral genetic diversity and polymorphisms in a cohort of HIV-1-infected patients eligible for initiation of antiretroviral therapy in Abuja, Nigeria. AIDS Res Hum Retroviruses, 2015