<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2-1-026 2-1-026 Nigeria 2008 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, I50V, V60I, T69S, K122E, D123N, F171Y, K173A, Q174K, D177E, I178M, T200A, Q207N, V245Q, E248D  
>2-1-026| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKVGPENPYNTPI
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRAKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20I, R41K, R57K, I64IL, C67E, H69K, V82I, L89M M36Q_X
>2-1-026| codons 15-99
IGGQLIEALLDTGADDTVLEEQNLPGKWKPKMIGGIGGFIKVKQYDQILLEIEGKKAIGT
VLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Diallo, K Viral genetic diversity and polymorphisms in a cohort of HIV-1-infected patients eligible for initiation of antiretroviral therapy in Abuja, Nigeria. AIDS Res Hum Retroviruses, 2015