<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2-1-043 2-1-043 Nigeria 2008 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, M36I, N37E, R41K, H69K, K70R, L89M  
>2-1-043| codons 15-99
IGGQLREALLDTGADDTVLEEIELPGKWKPKMIGGIGGFIKVRQYDQILIEICGKRAIGT
VLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, T39A, S48E, V60I, K102KQ, D123E, I135T, E138A, S162A, T165TAIV, K173KT, Q174DGNS, D177E, T200A, Q207E, R211RK, F214L, V245Q  
>2-1-043| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICAEMEKEGKIEKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQASMVKILEPFRTSNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEK

References
Author Title Citation
Diallo, K Viral genetic diversity and polymorphisms in a cohort of HIV-1-infected patients eligible for initiation of antiretroviral therapy in Abuja, Nigeria. AIDS Res Hum Retroviruses, 2015