<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1-1-022 1-1-022 Nigeria 2008 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20I, E35D, M36I, N37D, R41K, H69K, T74S, L89M  
>1-1-022| codons 15-99
IGGQLIEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAIGS
VLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K122E, I135V, S162A, K173I, Q174K, D177E, I178L, T200A, K201R, Q207E, R211RK, V245E  
>1-1-022| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPELVI
YQYMDDLYVGSDLEIGQHRARIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEK

References
Author Title Citation
Diallo, K Viral genetic diversity and polymorphisms in a cohort of HIV-1-infected patients eligible for initiation of antiretroviral therapy in Abuja, Nigeria. AIDS Res Hum Retroviruses, 2015