<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20I, E35D, M36I, N37D, R41K, H69K, T74S, L89M  
>1-1-022| codons 15-99
IGGQLIEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAIGS
VLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K122E, I135V, S162A, K173I, Q174K, D177E, I178L, T200A, K201R, Q207E, R211RK, V245E  
>1-1-022| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPELVI
YQYMDDLYVGSDLEIGQHRARIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEK

References
Author Title Citation
Ugbena, R Virological response and HIV drug resistance 12 months after antiretroviral therapy initiation at 2 clinics in Nigeria. Clin Infect Dis, 2012