<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2-1-136 2-1-136 Nigeria 2008 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, E35D, M36I, R41K, L63A, V82VI  
>2-1-136| codons 15-99
IGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIAIEICGHKAIGT
VLVGPTPINIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, E53ED, V60I, K122P, I135T, E169D, D177E, I178V, I202IV, E204K, Q207E, R211K, F214FL, P243PS, V245KQ, E248ED  
>2-1-136| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPDNPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEVVI
YQYMDDLYVGSDLEIGQHRTKVEKLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIQLPDK

References
Author Title Citation
Diallo, K Viral genetic diversity and polymorphisms in a cohort of HIV-1-infected patients eligible for initiation of antiretroviral therapy in Abuja, Nigeria. AIDS Res Hum Retroviruses, 2015