<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1-1-137 1-1-137 Nigeria 2008 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, S68G, K166R, F171Y, K173A, Q174K, D177E, I178M, T200V, Q207D, R211K, P243T, V245Q  
>1-1-137| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPYRAKNPEMVI
YQYMDDLYVGSDLEIGQHRVKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPEK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16GE, L19LP, K20I, E35D, M36I, R41K, L63S, H69K, K70KR, L89M  
>1-1-137| codons 15-99
IEGQPIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQISIEICGKRAIGT
VLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Diallo, K Viral genetic diversity and polymorphisms in a cohort of HIV-1-infected patients eligible for initiation of antiretroviral therapy in Abuja, Nigeria. AIDS Res Hum Retroviruses, 2015