<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
09AOHDP102 09AOHDP102 Angola 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14KE, I15V, G16E, L19I, K20M, E34A, M36I, P39PS, R41K, L63T, H69K, K70R, L89M, I93L  
>09AOHDP102| codons 1-99
PQITLWQRPLVSIEVEGQIMEALLDTGADDTVLAEINLSGKWKPKMIGGIGGFIKVRQYD
QITIEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, V35T, E36A, T39D, K122E, K173A, D177E, G196E, T200A, Q207E, V245Q, E248D, T286A, E291D, V292I, I293V, E298D  
>09AOHDP102| codons 1-301
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEDAE
L

References
Author Title Citation
Bartolo, I HIV-1 diversity, transmission dynamics and primary drug resistance in Angola. PLoS ONE, 2014