<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
449813_2 449813_2 South Africa 2010 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V V106M V179D, F227L V35T, E36A, T39D, S48T, K82R, K122E, K173A, D177E, T200A, Q207E, R211K, F214L, V245Q M16I, E203T
>449813_2| codons 1-255
PISPIETVPVKLKPGIDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIDI
YQYVDDLYVGSDLEIGQHRAKITELREHLLKWGLTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, R41K, L63I, H69K, L89I, I93L  
>449813_2| codons 24-99
LDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIIIEICGKKAIGTVLVGPTPVN
IIGRNILTQLGCTLNF

References
Author Title Citation
Hoffmann, CJ Resistance to tenofovir-based regimens during treatment failure of subtype C HIV-1 in South Africa. Antivir Ther, 2013