<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V V106M V179D, F227L V35T, E36A, T39D, S48T, K82R, K122E, K173A, D177E, T200A, Q207E, R211K, F214L, V245Q M16I, E203T
>449813_2| codons 1-255
PISPIETVPVKLKPGIDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIDI
YQYVDDLYVGSDLEIGQHRAKITELREHLLKWGLTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, R41K, L63I, H69K, L89I, I93L  
>449813_2| codons 24-99
LDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIIIEICGKKAIGTVLVGPTPVN
IIGRNILTQLGCTLNF

References
Author Title Citation
Hoffmann, CJ Resistance to tenofovir-based regimens during treatment failure of subtype C HIV-1 in South Africa. Antivir Ther, 2013