<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
491648_1 491648_1 South Africa 2010 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 FTC+LPV+TDF NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16GE, M36L, L63A, H69K, T74S, L89M, I93L  
>491648_1| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEELNLPGRWKPKMIGGIGGFIKVRQYD
QIAIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    V106M V179D V35T, T39E, S48T, K49KR, E53D, K102KR, K122E, D123N, K173T, D177E, T200A, Q207E, F214L, L228Q, V245C  
>491648_1| codons 1-255
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITRIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSMTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIDI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFQWMGYELHPDKWT
VQPICLPEKDSWTVN

References
Author Title Citation
Hoffmann, CJ Resistance to tenofovir-based regimens during treatment failure of subtype C HIV-1 in South Africa. Antivir Ther, 2013