<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
452356_2 452356_2 South Africa 2010 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V K70Q Y181C, G190A   V35M, E36A, T39E, K46Q, S48T, K122E, D123N, T139K, K173V, Q174K, T200A, Q207K, R211K, V245Q, D250E  
>452356_2| codons 1-255
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMAICEEMEKEGQITKIGPENPYNTPV
FAIKKKDSTQWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRVKNPDIVI
CQYVDDLYVASDLEIGQHRAKIEELRKHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, Q18E, L19I, M36I, R41K, D60E, Q61E, L63S, H69K, L89M, I93L  
>452356_2| codons 1-99
PQITLWQRPLVTIKVGGEIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
EISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Hoffmann, CJ Resistance to tenofovir-based regimens during treatment failure of subtype C HIV-1 in South Africa. Antivir Ther, 2013