<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
399048_1 399048_1 South Africa 2010 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, L19T, M36I, H69K, L89M, I93L  
>399048_1| codons 1-99
PQITLWQRPIVTIKIGGQTKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184I   K103N, M230L   V35T, T39E, S48T, K122E, D123N, K173A, Q174K, D177E, Q197P, T200A, Q207E, V245Q, S251N  
>399048_1| codons 1-255
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYIDDLYVGSDLEIGPHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWLGYELHPDKWT
VQPIQLPEKDNWTVN

References
Author Title Citation
Hoffmann, CJ Resistance to tenofovir-based regimens during treatment failure of subtype C HIV-1 in South Africa. Antivir Ther, 2013