<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 EFV+FTC+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C V108I K20R, K22R, V35T, T39K, E40D, S48T, V60I, K122E, D123S, I135V, T139S, K173E, Q174K, D177E, T200A, Q207E, F214L, V245Q, D250E  
>158876_1| codons 1-255
PISPIETVPVKLKPGMDGPRVRQWPLTEEKIKALTEICKDMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DESFRKYTAFTIPSVNNESPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREKNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19V, M36I, R41K, Q61H, H69K, V82I, L89M, I93L  
>158876_1| codons 1-99
PQITLWQRPLVTIKIGGQVKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
HILIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Hoffmann, CJ Resistance to tenofovir-based regimens during treatment failure of subtype C HIV-1 in South Africa. Antivir Ther, 2013