<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|AZT|EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LI, M184V, L210LW, T215Y V75VL, K219E G190S   V35L, E36N, I37F, T39R, K43E, K49R, K122E, D123S, K173S, Q174K, D177E, V179I, Q197EK, T200TA, I202IV, Q207A, V245M  
>R142| codons 35-247
LNFCRELEEEGKISRIGPENPYNTPVFAIKKKNSTRWRKILDFRELNKRTQDFWEVQLGI
PHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWK
GSPAIFQSSMTKILEPFRSKNPEIIIYQYVDDLYVSSDLEIGKHRAKVEELRAHLWRWGF
YTPDEKHQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, M36I, R41K, H69K, L89M, I93L  
>R142| codons 4-99
TLWQRPLVTIKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Dvali, N Characterization of HIV-1 subtypes and drug resistance mutations among individuals infected with HIV in Georgia. J Med Virol, 2012