<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|AZT|EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215HPSY K219KQ G190S, M230ML   K30Q, K32G, A33C, L34T, V35L, E36N, I37F, T39R, V106VI, K122E, D123N, I135T, S162C, K173L, Q174K, D177E, V179I, I202IV, Q207A, R211S, L228LR, V245M Q91Q*
>R053| codons 30-246
QIGCTLNFCREMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
V*LGIPHPAGLKKKKSITVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQCSMTKILEPFRLKNPEIIIYQYVDDLYVSSDLEIGQHRTKVEELRAHL
LSWGFYTPDQKHQKEPPFRWLGYELHPDKWTVQPIML

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, K14R, E35D, M36I, N37D, R41K, H69K, K70R, L89M G17R
>R053| codons 6-99
WQRPLVSVRIGRQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQILIE
ICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Dvali, N Characterization of HIV-1 subtypes and drug resistance mutations among individuals infected with HIV in Georgia. J Med Virol, 2012