<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|D4T|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184I A62V K101E, Y181YC, G190S   K30Q, K32G, A33C, L34T, V35L, E36N, I37F, T39K, V90I, K122E, D123N, A158S, K173L, Q174K, T200A, Q207A, R211S, V245M  
>R149| codons 30-247
QIGCTLNFCKEMEKEGKISKIGPENPYNTPVFVIKRKDSTKWRKLVDFRELNKRTQDFWE
IQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPSIFQSSMTKILEPFRLKNPDIVICQYIDDLYVSSDLEIGQHRAKIEELRAHL
LSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, L63P, H69K, V77I, L89M  
>R149| codons 4-99
TLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGKKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Dvali, N Characterization of HIV-1 subtypes and drug resistance mutations among individuals infected with HIV in Georgia. J Med Virol, 2012