<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|AZT|EFV|NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, N88NS L23LI, K43KT K14R, I15IV, K20T, E35D, M36I, N37D, R41K, L63P, H69K, A71AV, L89M, I93L  
>R005| codons 4-99
TLWQRPLVTIRVGGQLTEAILDTGADDTVLEDIDLPGKWTPKIIGGIGGFIKVRQYDQIP
IEICGKKVIGTVLVGPTPVNIIGRSMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V       V35L, E36N, I37F, T39D, W88C, K122E, D123S, I135T, K173L, Q174K, D177E, Q207A, R211S  
>R005| codons 35-247
LNFCDEMEKEGKISKIGPENPYNTPVFAIKKKDSTRWRKLVDFRELNKRTQDFCEVQLGI
PHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWK
GSPAIFQSSMTKILEPFRLKNPEIVIYQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGF
TTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Dvali, N Characterization of HIV-1 subtypes and drug resistance mutations among individuals infected with HIV in Georgia. J Med Virol, 2012