<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|D4T|NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI   I13V, K14R, G16E, E35D, M36I, R41K, E65EK, H69K, I72IT, L89M, I93IL  
>R045| codons 4-99
TLWQRPLVTVRIEGQLKEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYDQIL
IKICGKKATGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35L, E36N, I37F, T39D, E44EK, K102R, K122E, D123S, I135T, I142T, K173S, Q174K, D177E, Q207A, R211S, I244V D110DN
>R045| codons 35-247
LNFCDEMEKKGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGI
PHPAGLKRKKSVTVLNVGDAYFSVPLDESFRKYTAFTIPSTNNETPGTRYQYNVLPQGWK
GSPAIFQSSMTKILEPFRSKNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGF
TTPDKKHQKEPPFLWMGYELHPDKWTVQPVVLP

References
Author Title Citation
Dvali, N Characterization of HIV-1 subtypes and drug resistance mutations among individuals infected with HIV in Georgia. J Med Virol, 2012