<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  A62V     V35L, E36N, I37F, T39K, V90I, K122Q, D123N, A158S, K173L, Q174K, D177E, Q207A, R211S, P247PT  
>R074| codons 35-247
LNFCKEMEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGI
PHPAGLKKKKSVTVLDVGDAYFSVPLDQNFRKYTAFTIPSINNETPGIRYQYNVLPQGWK
GSPSIFQSSMTKILEPFRLKNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGF
TTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16GE, E35D, M36I, R41K, H69K, L89M, I93L  
>R074| codons 4-99
TLWQRPLVTIKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Dvali, N Characterization of HIV-1 subtypes and drug resistance mutations among individuals infected with HIV in Georgia. J Med Virol, 2012