<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, R41K, I62V, L63C, H69Q, A71T, V77I  
>CHU31| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QVCIEICGQKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, K49R, V60I, D123E, K166R, D177E, T200A, Q207E, R211K, P243A, V245R, K263N, A272P, K277R, T286A, I293V, M357A, A360T, I375V, T377V, K390R, E399D, A400T K20N
>CHU31| codons 1-424
PISPIETVPVKLKPGMDGPNVKQWPLTEEKIKALTDICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQAIRLPEKDSWTVNDIQKLVGNLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARARGT
HTNDVKQLTEAVQKVAVESIVIWGKTPKFRLPIQKETWDTWWTEYWQATWIPEWEFVNTP
PLVK

References
Author Title Citation
Niama, FR HIV-1 subtypes and recombinants in the Republic of Congo. Infect Genet Evol, 2006