<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, S24N, D41N, I72V, L101I, T112I, S119P, T124A, T125A, G134D, K136Q, Q177L, V201I, T206S, T218I, L234I S283G
>52_SUPLH02| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMANDFNLPPVVAKEIVASCNKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGPN
FTSAAVKAACWWADIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVLMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M Q58E L10I, I13V, I15V, L19I, K20I, M36I, R41K, L63P, H69K, L89M  
>52_SUPLH02| codons 1-99
PQITLWQRPIVTVKVGGQIIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFVKVREYD
QIPIEICGKKAIGTVLVGPTPANIIGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K103N V108I V35T, K43Q, V60I, V90I, K122P, D123E, I135T, S162H, K173N, Q174K, D177E, I178M, T200A, Q207G, V245Q, P247A, A272P, T286A, E291D, I293V, E297P, V317A, F346Y, M357T, R358K, G359S, E370G, T377M, S379C, K390R, E399D, A400T, K431T, V435A, N447S, L452Q, T470S, D471E, H483Y, L491S, L503I, K512R, E516D, S519N, Q524K, K527Q, E529D, A534S, A554S, I556V  
>52_SUPLH02| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEQEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DPEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRNKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELRGHLLRWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLAEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDVVPLTPEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYQIYQEPYKNLKTGKYARTKSA
HTNDVKQLTGAVQKIAMECIVIWGKTPKFRLPIQKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGAASRETKQGKAGYVTDRGRQKVVSLSETTNQKTELQ
AIYLALQDSGSEVNIVTDSQYAIGIIQAQPDRSESDLVNQIIEKLIQKDKVYLSWVPAHK
GIGGNEQVDKLVSSGVRKVL

References
Author Title Citation
Manak, M Pilot studies for development of an HIV subtype panel for surveillance of global diversity. ARHR, 2012