<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D3E, S17N, R20K, D41N, I72V, L101I, K111R, T112I, I113V, S119P, T124A, T125A, G134D, K136Q, V201I, T206S, L234I S283G
>53_SUPLH01| codons 1-288
FLEGIDKAQEEHEKYHNNWKAMASDFNLPPVVAKEIVASCNKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVRIVHTDNGPN
FTSAAVKAACWWADIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   L19I, K20R, E35D, M36I, R41K, K45Q, L63P, H69K, I85V, L89I  
>53_SUPLH01| codons 1-99
PQITLWQRPLVTIKIGGQIREALLDTGADNTVLEDINLPGKWKPQMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIVGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K103N   V35I, T39A, E40D, V60I, V90I, K102Q, K122P, D123E, I135T, S162Y, K173A, Q174K, D177E, I178M, T200A, E203D, Q207E, V245Q, A272P, T286A, A288T, E291D, V292I, I293V, E297T, V317A, G335D, F346Y, K350R, M357T, G359S, K366R, E370A, T377M, S379C, K390R, E399D, A400T, K431T, V435A, N447S, L452Q, T470A, D471E, T477A, L491S, L503M, K512R, E516D, S519N, K527Q, E529D, A534S, A554N, K558R  
>53_SUPLH01| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICADMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKQNKSVTVLDVGDAYFSVPL
DPEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRAKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIDELREHLLRWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTDIVPLTTEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQDQWTYQIYQEPYKNLRTGKYARTRSA
HTNDVRQLTAAVQKIAMECIVIWGKTPKFRLPIQKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGAASRETKQGKAGYVTDRGRQKVVSLAETTNQKAELQ
AIHLALQDSGSEVNIVTDSQYAMGIIQAQPDRSESDLVNQIIEQLIQKDKVYLSWVPAHK
GIGGNEQVDKLVSNGIRRVL

References
Author Title Citation
Manak, M Pilot studies for development of an HIV subtype panel for surveillance of global diversity. ARHR, 2012