<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, V31I, V37I, D41N, L101I, T112I, S119P, T124A, T125A, G134D, K136Q, V201I, T206S, L234I S283G
>48_SUPLH01| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPIVAKEIIASCNKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGPN
FTSAAVKAACWWADIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L33F, Q58E L10I, I13V, G16E, E35D_ED, M36I, R41K, I62V, H69K, V77I, L89M  
>48_SUPLH01| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVFEDINLPGKWKPKMIGGIGGFVKVREYD
QVLIEICGKKAIGTVLIGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219E Y181C A98G V35T, T39S, V60I, K122P, I135V, S162C, K173T, Q174R, D177E, I178L, T200A, E203D, Q207E, L228H, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, E297A, G333E, F346Y, M357T, G359S, K366R, T377M, S379C, K390R, Q394L, E399D, A400T, K431T, E432D, V435T, L452Q, T470S, D471E, H483Y, L491S, Q509K, K512R, E516D, S519N, Q524L, K527Q, E529D, A534S, A554N I505L
>48_SUPLH01| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICSEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTRNPELVI
CQYMDDLYVGSDLEIGQHRAKIDELREHLLRWGFFTPDEKHQKEPPFHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPYKNLKTGKYARTRSA
HTNDVRQLTEAVQKIAMECIVIWGKTPKFRLPILKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETDPITGAETFYVDGAANRETKQGKAGYVTDRGRQKVVSLSETTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGLIQAKPDRSESDLVNQIIELLIQKDKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Manak, M Pilot studies for development of an HIV subtype panel for surveillance of global diversity. ARHR, 2012