<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1144 CA2602 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI 57
3 AZT+DDI 8
4 AZT+DDC 35
5 3TC+D4T 13
6 AZT+D4T+RTV+SQV 57
7 AZT+D4T+RTV+SQV 27

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, L90M Q58E L10I, K14R, M46X, Q61E, I62V, L63P, A71V, V77I, I93L  
>CA2602| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKXIVGIGGFVKVREYD
EVPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q     V35M, T69N, V118I, K122E, I135T, I202V, F214L  
>CA2601| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001