<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 LPV+NNRTI+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82F L33I L10V, I13V, E35D, M36I, R41K, K45V, I62V, L63D, I64V, I72T  
>3259-HALD| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVIEDINLPGKWKPVMIGGIGGFAKVRQYD
QVDVEICGHKATGTVLVGPTPFNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V21I, V35T, T39A, K49R, V60VI, K122E, D123N, I135T, R172K, D177E, I178L, T200I, Q207E, R211K, F214L, V245K, E248D, S251I, A272P, K277R, T286A, E297K, K311R, I329V, Q334E, G335S Q182S
>3259-HALD| codons 1-344
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICAEMEKEGKISRIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPELVI
YSYVDDLYVGSDLEIGQHRIKIEELREHLLKWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPDKDIWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LELAENREILREPVHGVYYDPSKDLIAEVQKQGESQWTYQIYQE

References
Author Title Citation
Thiam, M HIV-1 genetic diversity and drug resistance among Senegalese patients in the public health system. J Clin Microbiol, 2013