<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 LPV+NNRTI+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, I84V Q58E L10I, I13V, G16E, K20I, M36I, R41K, L63HR, H69K, K70R, I72V, L89M  
>1837HALD| codons 1-99
PQITLWQRPIVTVKIEGQLIEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFVKVREYD
QIRIEICGKRAVGTVVVGPTPVNVIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       V35T, T39K, K43E, E44D, K49R, V60I, A98AP, D123EK, R125RK, T131P, E169Q, K173T, Q174K, D177E, I178M, T200A, E203D, Q207E, R211K, T216TP, V245Q F77FSY, D113E, N136NK, T139TP
>1837HALD| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKELEEDGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDYRELNKRTQDFWEVQLGIPHPPGLKKKKSVTVLDVGEAYFSVPL
DKKFKKYTAFPIPSIKNEPPGIRYQYNVLPQGWKGSPAIFQSSMTKILQPFRTKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIDELREHLWKWGFYPPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKD

References
Author Title Citation
Thiam, M HIV-1 genetic diversity and drug resistance among Senegalese patients in the public health system. J Clin Microbiol, 2013