<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 LPV+NNRTI+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, I84V V11I, L89V L10I, I13V, L19P, K20I, E35D, M36I, R41K, I62V, H69K, K70R, A71V, I72IR, P79AS, T91TS, Q92QK  
>2841-HALD| codons 1-99
PQITLWQRPIITVKIGGQPIEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QVLIEICGKRVRGTVVVGSTPVNVIGRNVLSKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y   K103N A98G, V108I E28K, K32I, V35T, T39K, K43E, V60I, K101A, V118I, K122E, D123S, K173T, Q174K, D177E, T200A, E203K, Q207D, R211K, K223E, L228R, V245Q, T286A, E291D, I293V, P294T  
>2841-HALD| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIIALTEICKELEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPGGLAKNKSVTILDVGDAYFSIPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIKELRDHLWKWGFYTPDKKHQEEPPFRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Thiam, M HIV-1 genetic diversity and drug resistance among Senegalese patients in the public health system. J Clin Microbiol, 2013