<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F D67G, K219E K103N A98G, V108I V35T, E36D, T39L, K49R, S68G, K101KR, K122E, I135V, S162A, E169K, K173T, Q174E, D177E, I178M, T200A, E203K, Q207E, R211K, K223E, P243S, V245Q, E248D, T286A, E291D, I293IV, P294T, L295LM, S322T, I326V, I329IV  
>3210-HALD| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICLEMEKEGKISRIGPENPYNTPV
FAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLRKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILKPFRTENPEMVI
YQYVDDLYVGSDLEIGQHRAKIKELREHLLKWGFFTPDEKHQEEPPFLWMGYELHPDKWT
VQSIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTMTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEVQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, I15IV, K20I, M36I, N37NDEK, R41RK, K43KR, L63P, H69K, A71T, L89I  
>3210-HALD| codons 1-99
PQITLWQRPLVTAKVGGQLIEALLDTGADDTVLEEIKLPGKWRPKMIGGIGGFIKVRQYD
QIPIEICGKKTIGTVLVGPTPVNIIGRNILTQIGCTLNF

References
Author Title Citation
Thiam, M HIV-1 genetic diversity and drug resistance among Senegalese patients in the public health system. J Clin Microbiol, 2013