<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV T215TS, K219KE Y181C   I5V, E6D, K11T, K32E, V35T, E36D, V60I, I135V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, R211K, K223X, L228R W24R, W229WG
>7164-HALD| codons 1-234
PISPVDTVPVTLKPGMDGPKVKQRPLTEEKIEALTDICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFSTPDEKHQXEPPFRGMGYEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TA, K14R, G16A, N37D, R57K, D60E, Q61G, L63T, C67E, H69K, I72IATV, V77I  
>7164-HALD| codons 1-99
PQITLWQRPLVAIRIAGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVKQYE
GITIEIEGKKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Thiam, M HIV-1 genetic diversity and drug resistance among Senegalese patients in the public health system. J Clin Microbiol, 2013