<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, E35D, M36I, N37D, R41K, H69K, T74S, V77I, L89M  
>680-HALD| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V21I, V35Q, V60I, T69N, D121Y, K122E, D123DG, S162C, K173T, Q174K, D177E, I178L, T200A, Q207E, R211K, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, E297A, K311KR, S322SA  
>680-HALD| codons 1-333
PISPIETVPVKLKPGMDGPRIKQWPLTEEKIKALQEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILREPVHGVYYDPAKDLIAEIQKQG

References
Author Title Citation
Thiam, M HIV-1 genetic diversity and drug resistance among Senegalese patients in the public health system. J Clin Microbiol, 2013