<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y V75I K103N K238T V35T, I132L, Y144X, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, V245Q, E291D, V292I, I293V, P294T, E312D, S322A, I326V, K331N G45GR
>2523-HALD| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKERKISKIGPENPYNTPV
FAIKKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTLPSINNETPGIRXQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDTWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDIVTLTEEAE
LELAENREILKDPVHGVYYDPAKDLVAEIQNQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12K, I13V, K14R, G16E, K20I, M36I, N37S, R41K, H69K, L89M  
>2523-HALD| codons 1-99
PQITLWQRPVVKVRIEGQLIEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Thiam, M HIV-1 genetic diversity and drug resistance among Senegalese patients in the public health system. J Clin Microbiol, 2013