<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2666-HALD 2666-HALD Senegal 2008 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I T12K, I13V, L19I, K20I, E35N, M36I, R41K, H69K, L89M  
>2666-HALD| codons 1-99
PQITLWQRPLIKVKIGGQIIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C   E6Q, K11T, V35T, E36A, T39K, K43E, D86E, D121H, K122E, I135T, I142V, S162F, M164*, K173S, T200A, Q207A, V245E, K281R, T286A, E291D, V292I, I293V, P294T, L295M, K311R, S322T T165Q, Y319YH
>2666-HALD| codons 1-334
PISPIQTVPVTLKPGMDGPKVKQWPLTEEKIKALTAICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQFS*QKILEPFRSQNPDIVI
CQYVDDLYVGSDLEIGQHRAKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTMTEEAE
LELAENREILREPVHGVYHDPTKDLIAEIQKQGQ

References
Author Title Citation
Thiam, M HIV-1 genetic diversity and drug resistance among Senegalese patients in the public health system. J Clin Microbiol, 2013