<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, I84V L33I, G73S L10I, V11L, I13V, L19P, K20I, M36I, R41K, Q61H, L63V, H69K, K70R, A71V, I72T, P79A, N83S, L89T  
>133-HALD| codons 1-99
PQITLWQRPILTVKIGGQPIEALLDTGADDTVIEEINLPGKWKPKIVGGIGGFVKVRQYD
HIVIEICGKRVTSTVLVGATPVSVIGRNTLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219KN     V35T, T39K, K43E, E44D, V60I, W88WC, V118I, K122E, D123E, I135L, S162A, K173T, Q174K, D177E, T200A, Q207E, R211K, V245K, I257V, T286A, E291D, V292I, I293V, P294T, L295M, S322A, I326V, K331N, Q332QK  
>133-HALD| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKELEEDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDVQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTMTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQNKGQG

References
Author Title Citation
Thiam, M HIV-1 genetic diversity and drug resistance among Senegalese patients in the public health system. J Clin Microbiol, 2013