<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I L10V, I13V, K14R, G17E, K20I, M36I, R41K, H69K, K70R, L89M  
>750HALD| codons 1-99
PQITLWQRPVITVRIGEQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215SY   K103N P225PH, K238KT K20R, V35T, E36D, T39S, K49KR, D123E, I135IT, A158AS, S162A, K173T, Q174K, N175H, D177E, I178M, T200EK, Q207E, P243H, V245Q K201N
>750HALD| codons 1-258
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTDICSEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRTKHPEMVI
YQYVDDLYVGSDLEIGQHRKNIEELREHLLRWGFYTPDKKHQKEHPFLWMGYELHPDTWT
VQHIQLPEKDSWTVNDIQ

References
Author Title Citation
Thiam, M HIV-1 genetic diversity and drug resistance among Senegalese patients in the public health system. J Clin Microbiol, 2013