<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
619-HPD 619-HPD Senegal 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V   K103N P225H V35T, K122E, I135T, I142V, S162Y, K173S, Q174K, D177E, V179I, Q207A, R211K, V245Q K102Y
>619-HPD| codons 1-271
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKYNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRSKNPEIII
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLKWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19LP, K20I, M36I, R41K, L63P, H69K, V82I, L89M  
>619-HPD| codons 1-99
PQITLWQRPLVTVKIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Thiam, M HIV-1 genetic diversity and drug resistance among Senegalese patients in the public health system. J Clin Microbiol, 2013