<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, M184V   Y181C, Y188L A98G K11R, V35T, T39E, K46Q, S48T, S68G, V106I, D121H, K122E, I135T, T139A, I142V, S162CY, K173S, D177E, T200A, I202V, Q207E, R211K, V245Q  
>5294HALD| codons 1-249
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGQITKIGPENPYNTPV
FAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSITVLDVGDAFFSVPL
HEDFRKYTAFTIPSTNNEAPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRSQNPEIVI
CQYVDDLLVGSDLEIGQHRAKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, I15V, L19S, K20I, E21ED, E35D, M36I, R41K, I64M, H69K, L89M  
>5294HALD| codons 1-99
PQITLWQRPLVSVKVGGQSIDALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Thiam, M HIV-1 genetic diversity and drug resistance among Senegalese patients in the public health system. J Clin Microbiol, 2013