<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1141 CA2591 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI 17
2 3TC+AZT+IDV 27
3 3TC+D4T+DDI 9
4 3TC+D4T+IDV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A G73C L10I, I15V, M36I, N37D, K45R, I62V, L63P, I72E  
>CA2591| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEIDLPGRWKPRMIGGIGGFVKVRQYD
QVPIEICGHKAECTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y V75A     V35I, T39A, E40F, K43E, V118I, D177E, G196E, Q207K, H208Y, R211E  
>CA2590| codons 1-233
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLADFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRKYLWEWGFYTPDKKHQKEPPFLWMGYE

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: clinical and genotypic predictors of virologic response. JAIDS, 2000
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005