<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KF347 KF347 Ghana 2010 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, E35D, M36I, R41K, L63T, H69K, L89M  
>KF347| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN, Y188FL   V8I, K11T, V35T, E36A, T39K, K43E, V60I, K122E, D123N, T139K, S162H, F171Y, K173A, I178M, V179I, T200A, Q207A, R211RK, V245Q, E248H  
>KF347| codons 1-266
PISPIETIPVTLKPGMDGPKVKQWPLTEEKIKALTAICKEMEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPYRAQNPDMII
YQYMDDLLVGSDLEIGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPHKDSWTVNDIQKLVGKLNW

References
Author Title Citation
Nii-Trebi, NI HIV-1 drug-resistance surveillance among treatment-experienced and -naive patients after the implementation of antiretroviral therapy in Ghana. PLoS ONE, 2013