<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 ABC+DDI+LPV 52
2 ABC+AZT+LPV 327

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M L10F, N88D T12S, I15V, L19I, K20R, E35D, M36I, R41K, K55R, L63P, H69K, L89M, I93L  
>943| codons 4-99
TLWQRPFVSIKVGGQIREALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIRVRQYDQIP
IEICGKKAIGTVLVGPTPVNIIGRDMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L       T39E, E44D, K49KR, E53D, K64KR, A98S, K122E, D123S  
>943| codons 38-157
CEELEKDGKISRIGPDNPYNTPVFAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP

References
Author Title Citation
Grossman, Z Comparable long-term efficacy of lopinavir/ritonavir and similar drug-resistance profiles in different HIV-1 subtypes. PLoS ONE, 2014