<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 IDV|NFV|RTI NA
2 3TC+AZT+LPV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54M N83D L10I, M36I, R41K, I62V, L63V, T74S, V82I, I85V, L89I, I93L  
>464| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTILEEINLPGKWKPKMVGGIGGFMKVRQYDQVV
IEICGHKAIGSVLVGPTPIDIVGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, D67N, K70KR, M184V, T215CY K219Q K101E, G190A   T39E, K122E, D123G, A158S, K173T, Q174K, D177E, I178LV, T200A, Q207E, R211K, V245K P59PA, H96HQ, L120LV, F130L
>464| codons 38-247
CEEMEKEGKISKIGPENPYNTAVFAIKRKNSTRWRKLVDFRELNKRTQDFWEVQLGIPQP
AGLEKKKSVTVLDVGDAYFSVPVDEGFRKYTALTIPSINNETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILEPFRTKNPEVVIYQYVDDLYVASDLEIGQHRAKIEELREHLLKWGFYTP
DQKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Grossman, Z Comparable long-term efficacy of lopinavir/ritonavir and similar drug-resistance profiles in different HIV-1 subtypes. PLoS ONE, 2014