<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, G16E, E35D, M36I, R41K, R57K, L63V, H69K, L89M  
>494H| codons 1-99
PQITLWQRPIVTVRIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103KN, G190GA V108VI V35T, T39M, S48T, V60I, K122E, D123DN, I135T, T139TKR, K173S, Q174K, V179I, T200IV, I202IV, Q207A, R211K, V245E, D250E, K281R, T286A, E291D, I293V, P294T, E312D, V317A, D324DE  
>494H| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DENFRKYTAFTIPSTNNERPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPDIII
YQYVDDLYVASDLEIGQHRVKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDVVTLTEEAE
LELAENREILKDPVHGAYYDPSKELIAEIQKQGQG

References
Author Title Citation
Rusine, J Low primary and secondary HIV drug-resistance after 12 months of antiretroviral therapy in human immune-deficiency virus type 1 (HIV-1)-infected individuals from Kigali, Rwanda. PLoS ONE, 2013