<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1131 CA2579 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 3TC+D4T+SQV NA
3 Unknown NA
4 None 143

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14KR, I15V, L19LQ, N37C, R41X, V82I  
>CA2579| codons 1-99
PQITLWQRPLVTIRVGGQQKEALLDTGADDTVLEEMCLPGXWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPINIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N T215V, K219Q     K20KR, V35I, V60I, V118I, K122E, I135T, Q174N, Q207E, R211K, F214L, V245X  
>CA2578| codons 1-253
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKNNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGLVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIXLPEKDSWT

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005