<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 LPV+NNRTI+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20I, M36I, R41K, K43R, H69K, L89M  
>LL4419| codons 1-99
PQITLWQRPLVTVKIEGQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M A62V, V75I, F77L K103N, Y181C   A33V, V35T, T39L, T69N, K101KR, V111I, V118VI, K122E, D123N, I135V, S162A, K173T, Q174K, D177E, I178M, G196E, T200A, Q207E, F214L, H221Y, L228R, P243H, V245E, E248D, K275R, T286A, E291D, P294T, V317A, D320DE, S322T, I329V  
>LL4419| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKVLTEICLEMEKEGKISKIGPENPYNTPV
FVIKKKDSNKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLRKNKSVTVLDIGDAYFSIPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQASMTKILEPFRTKNPEMVI
CQYMDDLYVGSDLEIEQHRAKIEELREHLLRWGLTTPDKKYQKEPPFRWMGYELHPDKWT
VQHIELPDKDSWTVNDIQKLVGKLNWASQIYAGIRVKQLCKLLRGAKALTDVITLTEEAE
LELAENREILKEPVHGAYYEPTKDLIAEVQKQGQ

References
Author Title Citation
Rawizza, HE Accumulation of protease mutations among patients failing second-line antiretroviral therapy and response to salvage therapy in Nigeria. PLoS ONE, 2013