<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 LPV+NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219E K103N A98G K20R, V35T, V60I, K122E, K173T, Q174K, D177E, I178M, T200A, E203K, Q207E, H208Y, R211K, V245Q, E248D, A272P, E291D, V292I, I293V, E297K  
>LL3229| codons 1-320
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIKELREYLLKWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTKEAE
LELAENREILKEPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50IV, I54IV, V82IS T74TP L10M, I13V, K14R, K20I, M36I, R41K, R57K, Q61QH, L63P, C67E, H69K, A71AV, L89M E35H
>LL3229| codons 1-99
PQITLWQRPMVTVRIGGQLIEALLDTGADDTVLEHINLPGKWKPKIIGGVGGFVKVKQYD
HIPIEIEGKKVIGPVLVGPTPSNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rawizza, HE Accumulation of protease mutations among patients failing second-line antiretroviral therapy and response to salvage therapy in Nigeria. PLoS ONE, 2013