<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 LPV+NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, T215Y K219E Y188L   I2V, P4PS, E6EK, V35T, T39K, E40D, V60I, K104R, V118I, K122E, D123N, T165I, K173T, Q174K, D177E, V189I, T200A, E203K, Q207E, H208Y, R211K, F214L, K223E, V245Q, E248N, D250E, S251N, A272P, K275R, Q278N, R284K, T286A, E291D, V292I, I293V, E297K, I329V  
>PJ4671| codons 1-333
PVSSIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKDMEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRTKNPEIVI
YQYVDDLLIGSDLEIGQHRAKIKELREYLLKWGLYTPDEKHQEEPPFLWMGYELHPDKWT
VQPIQLPNKENWTVNDIQKLVGKLNWASQIYPGIRVKNLCKLLKGAKALTDIVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T L24I L10I, I13V, K14R, G17E, K20I, E35Q, M36I, R41K, R57K, I62V, L63P, C67E, H69K, L89M  
>PJ4671| codons 1-99
PQITLWQRPIVTVRIGEQLIEALIDTGADDTVLEQINLPGKWKPKIIGGIGGFVKVKQYD
QVPIEIEGKKAIGTVLVGPTPTNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rawizza, HE Accumulation of protease mutations among patients failing second-line antiretroviral therapy and response to salvage therapy in Nigeria. PLoS ONE, 2013