<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 LPV+NNRTI+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82IS   I13V, K14R, K20I, E35Q, M36I, N37D, R41K, R57K, Q61H, L63P, C67E, H69K, L89M  
>PJ8953| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEQIDLPGKWKPKIIGGIGGFVKVKQYD
HIPIEIEGKKAIGTVLVGPTPSNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_EA, M184V, T215Y D67DG K103N A98G V35T, E44ED, V60I, I94IL, V118VI, K122E, D123S, I132V, K173T, Q174K, D177E, I178L, T200A, Q207N, L210LS, V245Q, E248D, D250E, A272P, E291D, V292I, I293V, E297EK  
>PJ8953| codons 1-318
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKDGKISKIGPENPYNTPI
FAIKKKGSSKWRKLVDFRELNKRTQDFWEVQLGLPHPGGLKKNKSVTVLDVGDAYFSIPL
DESFRKYTAFTVPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPELVI
YQYVDDLYVGSDLEIGQHRAKIEELRNHLSRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTKEAE
LELAENREILKEPVHGVY

References
Author Title Citation
Rawizza, HE Accumulation of protease mutations among patients failing second-line antiretroviral therapy and response to salvage therapy in Nigeria. PLoS ONE, 2013